DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33772

DIOPT Version :8

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster

Alignment Length:182 Identity:38/183 (21%)
Similarity:78/183 (43%) Gaps:31/183 (17%)


  Fly     7 IVVILVTFLLTWRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATI-HHPTND 70
            |::.||:..|..:  .::.:.|...|..:.|..::::.|.   |::::.|..|....: .:.|.|
  Fly    12 IILCLVSRFLEGQ--KTLNFLLFRKIVANHNSKYISLYEA---AISQDHTTINITLNLARNITAD 71

  Fly    71 V----VIDYRFLKRENGYKPWLYKKNIDGCRFL--RKPYDMLTKMIYMVFKPFSNINHTCPFYGD 129
            |    .|..|..|....|:. ::..|::.|:.:  .|...::...:..:.:. ||:...||    
  Fly    72 VWLKATIGQRVSKSGESYRD-VFTYNVNLCQVMGRGKGISLINFWMNNILRQ-SNMPRNCP---- 130

  Fly   130 ILIRGMY----LRTEIKAMP--YPSGKYMLQINWSFY----KKIQVVTNISY 171
             |..|.|    :|:|.:.:|  ..||.:  :|:.|.|    ..:.:...|.|
  Fly   131 -LREGNYYMRNIRSEKETIPRFIRSGSF--RIDSSVYVRDWNSVNLTETIFY 179

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 17/84 (20%)
CG33772NP_001027146.4 DUF1091 89..182 CDD:301369 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.