DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33772

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster


Alignment Length:99 Identity:21/99 - (21%)
Similarity:37/99 - (37%) Gaps:20/99 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 ILANHVKAVRRMRELLTTKFPAGTFPVKLSIPVIPTVKVVMTFSKFVALPPLDEFYTPLSSPKHL 459
            :....::..::..|||..|.|.    .:|...:....|..:.|.....| .|.|     ::..:|
  Fly    47 VALREIRKYQKSTELLNRKLPF----QRLVREIAQDFKTDLRFQSHAVL-ALQE-----AAEAYL 101

  Fly   460 LAAMEDQH--DVH--------DDEKLDRRISSSR 483
            :...||.:  .:|        .|.:|.|||.:.|
  Fly   102 VGLFEDTNLCAIHAKRVTIMPKDVQLARRIRAER 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928
CG33772NP_001027146.4 DUF1091 89..182 CDD:472716 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.