DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33792

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:69/171 - (40%) Gaps:18/171 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVILVTFLLTWRLSYSVTY--KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTND 70
            |.:.|...|...:.||..|  |:....|.: |.::.:...|.||.||..|:|.|.:..|.....|
  Fly    11 VYLGVLLCLPNTIFYSNGYFFKIRKTECIA-NGAYFSNVSCILKPVNWTRSVLNMDGDIKEALTD 74

  Fly    71 VVIDYRFLKRE--NGYKPWLYKKNIDGCRFLRK--PYDMLTKMIYMVFKPFSNINHTCPFYGDIL 131
            :.:......::  |.|||:..|...|.|:.|:.  ..:.|.|........::|:||:||:...:.
  Fly    75 IKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLC 139

  Fly   132 IRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYD 172
            |..:     :|...|....||      |.|...:..|...|
  Fly   140 IYNI-----VKFSQYIEYIYM------FLKGHLIARNFRLD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 19/79 (24%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 24/99 (24%)

Return to query results.
Submit another query.