DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33792

DIOPT Version :9

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:69/171 - (40%) Gaps:18/171 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VVILVTFLLTWRLSYSVTY--KLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTND 70
            |.:.|...|...:.||..|  |:....|.: |.::.:...|.||.||..|:|.|.:..|.....|
  Fly    11 VYLGVLLCLPNTIFYSNGYFFKIRKTECIA-NGAYFSNVSCILKPVNWTRSVLNMDGDIKEALTD 74

  Fly    71 VVIDYRFLKRE--NGYKPWLYKKNIDGCRFLRK--PYDMLTKMIYMVFKPFSNINHTCPFYGDIL 131
            :.:......::  |.|||:..|...|.|:.|:.  ..:.|.|........::|:||:||:...:.
  Fly    75 IKMSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLC 139

  Fly   132 IRGMYLRTEIKAMPYPSGKYMLQINWSFYKKIQVVTNISYD 172
            |..:     :|...|....||      |.|...:..|...|
  Fly   140 IYNI-----VKFSQYIEYIYM------FLKGHLIARNFRLD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 19/79 (24%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:284008 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.