DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33654

DIOPT Version :8

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster

Alignment Length:183 Identity:51/184 (28%)
Similarity:89/184 (48%) Gaps:44/184 (24%)


  Fly     7 IVVILVTFLLT-WRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTND 70
            ||||||..|:. |.   |..::.||:.|.|.::|:.....|.:::.||:                
  Fly     9 IVVILVILLMAKWA---SSKFEFTNLQCTSFDKSFDDFEYCYIRSANRS---------------- 54

  Fly    71 VVIDYRFL---------KRENGYKPWLYKKNIDGCRFLR----KPYDMLTKMIYMVFKPFSNINH 122
                |::|         .|.|||:|:::...:|.||||:    ||   :.|..|..|..:||:||
  Fly    55 ----YKYLTLKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKP---IAKYFYEFFNSYSNLNH 112

  Fly   123 TCPFYGDILIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNISY 171
            :|||..|:::..:   ::...: ..:|:|.|.|:|:.:|..|:..:.:..|.|
  Fly   113 SCPFNHDLIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYY 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:284008 28/93 (30%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 27/90 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298869
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.