DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33795 and CG33654

DIOPT Version :10

Sequence 1:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:183 Identity:51/183 - (27%)
Similarity:89/183 - (48%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IVVILVTFLLT-WRLSYSVTYKLTNVICESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTND 70
            ||||||..|:. |.   |..::.||:.|.|.::|:.....|.:::.||:                
  Fly     9 IVVILVILLMAKWA---SSKFEFTNLQCTSFDKSFDDFEYCYIRSANRS---------------- 54

  Fly    71 VVIDYRFL---------KRENGYKPWLYKKNIDGCRFLR----KPYDMLTKMIYMVFKPFSNINH 122
                |::|         .|.|||:|:::...:|.||||:    ||   :.|..|..|..:||:||
  Fly    55 ----YKYLTLKVNLFKTPRFNGYRPFMFNITLDACRFLKNTDSKP---IAKYFYEFFNSYSNLNH 112

  Fly   123 TCPFYGDILIRGM---YLRTEI-KAMPYPSGKYMLQINWSFYKKIQVVTNISY 171
            :|||..|:::..:   ::...: ..:|:|.|.|:|:.:|..|:..:.:..|.|
  Fly   113 SCPFNHDLIVDKIPIDFVNHRVTNILPFPEGDYLLETHWIAYEIDRAMVKIYY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 28/92 (30%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:461928 27/89 (30%)

Return to query results.
Submit another query.