DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and HSPB9

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_149971.1 Gene:HSPB9 / 94086 HGNCID:30589 Length:159 Species:Homo sapiens


Alignment Length:78 Identity:20/78 - (25%)
Similarity:39/78 - (50%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKS--EQQEAEQGGYSSRHFLRRFVLPEGYEADK 121
            :||:::.||...::  ||.|:| |...::|.|:.  :.::.|:..|.....:.|.:||.......
Human    51 RDGFQMKLDAHGFAPEELVVQV-DGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTA 114

  Fly   122 VTSTLSSDGVLTI 134
            :|..|:..|.|.:
Human   115 MTCCLTPSGQLWV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 20/78 (26%)
metazoan_ACD 61..138 CDD:107247 20/78 (26%)
HSPB9NP_149971.1 ACD_HspB9_like 45..131 CDD:107236 20/78 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.