DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSPB9

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_149971.1 Gene:HSPB9 HGNCID:30589 Length:159 Species:Homo sapiens

Alignment Length:78 Identity:20/79 (25%)
Similarity:39/79 (49%) Gaps:5/79 (6%)


  Fly    61 KDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKS--EQQEAEQGGYSSRHFLRRFVLPEGYEADK 121
            :||:::.||...::  ||.|:| |...::|.|:.  :.::.|:..|.....:.|.:||.......
Human    51 RDGFQMKLDAHGFAPEELVVQV-DGQWLMVTGQQQLDVRDPERVSYRMSQKVHRKMLPSNLSPTA 114

  Fly   122 VTSTLSSDGVLTI 134
            :|..|:..|.|.:
Human   115 MTCCLTPSGQLWV 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 20/79 (25%)
metazoan_ACD 61..138 CDD:107247 20/79 (25%)
HSPB9NP_149971.1 ACD_HspB9_like 45..131 CDD:107236 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C64749203
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.