DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSP26

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_009628.1 Gene:HSP26 SGDID:S000000276 Length:214 Species:Saccharomyces cerevisiae

Alignment Length:144 Identity:33/145 (23%)
Similarity:59/145 (41%) Gaps:48/145 (33%)


  Fly    36 VALPRNW---------QQIARWQEQE-------FAPPATVNKDGYKLTLDVKDYS---ELKVKV- 80
            ||.|.|:         :.:..|.:.:       |..|.:|     .:.:|:.|:.   ||||.| 
Yeast    52 VARPNNYAGALYDPRDETLDDWFDNDLSLFPSGFGFPRSV-----AVPVDILDHDNNYELKVVVP 111

  Fly    81 -------------LDESVVLVEG-------KSEQQEAEQGGYSSRHFLRRFVLPE--GYEADKVT 123
                         .:::.:||.|       :..:.:.:....||..|.|...||:  |.:||.:.
Yeast   112 GVKSKKDIDIEYHQNKNQILVSGEIPSTLNEESKDKVKVKESSSGKFKRVITLPDYPGVDADNIK 176

  Fly   124 STLSSDGVLTISVP 137
            :.. ::||||::||
Yeast   177 ADY-ANGVLTLTVP 189

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 33/145 (23%)
metazoan_ACD 61..138 CDD:107247 25/104 (24%)
HSP26NP_009628.1 IbpA 72..205 CDD:223149 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126935
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.