DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and AT1G59860

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 / 842280 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana


Alignment Length:122 Identity:37/122 - (30%)
Similarity:62/122 - (50%) Gaps:28/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEG-----KSEQQ------EAEQGG 101
            |:|       |.....:|..|......|:||::.|:||:.:.|     |.|:|      |...||
plant    50 WKE-------TAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGG 107

  Fly   102 YSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREV-TIEQTG 157
            :|     |:|.|||..:.|:|.::: .:||||::||.   |:...|:.:| :|:.:|
plant   108 FS-----RKFRLPENVKMDQVKASM-ENGVLTVTVPK---VETNKKKAQVKSIDISG 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 28/87 (32%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 31/100 (31%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 - -
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.