DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and AT1G59860

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana

Alignment Length:122 Identity:37/123 (30%)
Similarity:62/123 (50%) Gaps:28/123 (23%)


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEG-----KSEQQ------EAEQGG 101
            |:|       |.....:|..|......|:||::.|:||:.:.|     |.|:|      |...||
plant    50 WKE-------TAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGG 107

  Fly   102 YSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREV-TIEQTG 157
            :|     |:|.|||..:.|:|.::: .:||||::||.   |:...|:.:| :|:.:|
plant   108 FS-----RKFRLPENVKMDQVKASM-ENGVLTVTVPK---VETNKKKAQVKSIDISG 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 36/118 (31%)
metazoan_ACD 61..138 CDD:107247 29/88 (33%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 32/101 (32%)
IbpA <48..152 CDD:223149 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126935
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.