DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and AT1G54050

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001323264.1 Gene:AT1G54050 AraportID:AT1G54050 Length:155 Species:Arabidopsis thaliana

Alignment Length:94 Identity:25/95 (26%)
Similarity:46/95 (48%) Gaps:18/95 (19%)


  Fly    64 YKLTLDVK--DYSELKVKVLDESVVLVEG----KSEQQEAEQGGYSSR-------HFLRRFVLPE 115
            |...||:.  ..|:::|.|.:|..::::.    |.:..|:|:|....|       :.:::|.|||
plant    53 YIFYLDIPGISKSDIQVTVEEERTLVIKSNGKRKRDDDESEEGSKYIRLERRLAQNLVKKFRLPE 117

  Fly   116 GYEADKVTSTLSSDGVLTISV----PNPP 140
            ..:...||:.. .:||||:.:    |.||
plant   118 DADMASVTAKY-QEGVLTVVIKKLPPQPP 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 25/95 (26%)
metazoan_ACD 61..138 CDD:107247 23/91 (25%)
AT1G54050NP_001323264.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.