DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and AT1G53540

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_175759.1 Gene:AT1G53540 AraportID:AT1G53540 Length:157 Species:Arabidopsis thaliana

Alignment Length:141 Identity:37/142 (26%)
Similarity:65/142 (46%) Gaps:21/142 (15%)


  Fly    23 PFHAF-----FHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLD 82
            ||..|     ....|...||...|.:  ..|:|   .|.|.|    :|..|......|:||:|.|
plant    26 PFEGFLTPSGLANAPAMDVAAFTNAK--VDWRE---TPEAHV----FKADLPGLRKEEVKVEVED 81

  Fly    83 ESVVLVEGKSEQQEAEQGG------YSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPG 141
            .:::.:.|:...:..|:..      .||..|.|||.|||..:.:::.::: .:|||:::||..|.
plant    82 GNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASM-ENGVLSVTVPKVPE 145

  Fly   142 VQETLKEREVT 152
            .:..:|..:::
plant   146 KKPEVKSIDIS 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 37/142 (26%)
metazoan_ACD 61..138 CDD:107247 23/83 (28%)
AT1G53540NP_175759.1 IbpA 11..156 CDD:223149 37/140 (26%)
ACD_ScHsp26_like 51..142 CDD:107229 28/101 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126935
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.