DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and AT1G52560

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_175665.1 Gene:AT1G52560 AraportID:AT1G52560 Length:232 Species:Arabidopsis thaliana

Alignment Length:166 Identity:32/167 (19%)
Similarity:69/167 (41%) Gaps:53/167 (32%)


  Fly    39 PRNWQQIARWQE-----------QEFAPP--------ATVN----------------------KD 62
            ||...:.:.|:.           .||.||        ||.|                      .|
plant    70 PRRRGRKSLWRNTDDHGYFTPTLNEFFPPTIGNTLIQATENMNRIFDNFNVNPFQLMGQVKEQDD 134

  Fly    63 GYKLTLDVKDYSELKVKV-LDESVVLVEG--KSEQQEA---EQGGYSSR---HFLRRFVLPEGYE 118
            .|||..:|...::..||: :::.::.::|  |:|:::.   |...:||:   ::.....||:..:
plant   135 CYKLRYEVPGLTKEDVKITVNDGILTIKGDHKAEEEKGSPEEDEYWSSKSYGYYNTSLSLPDDAK 199

  Fly   119 ADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIE 154
            .:.:.:.| .:|||.:.:|.....::.:  :|:::|
plant   200 VEDIKAEL-KNGVLNLVIPRTEKPKKNV--QEISVE 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 31/165 (19%)
metazoan_ACD 61..138 CDD:107247 20/86 (23%)
AT1G52560NP_175665.1 IbpA 106..232 CDD:223149 24/129 (19%)
ACD_sHsps-like 129..218 CDD:107221 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.