DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and AT1G07400

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana

Alignment Length:117 Identity:37/118 (31%)
Similarity:63/118 (53%) Gaps:18/118 (15%)


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEG-----KSEQQEA-EQGGYSSRH 106
            |:|       |.....:|..|......|:||::.|:||:.:.|     |.|:|:. .:...||..
plant    52 WKE-------TAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQ 109

  Fly   107 FLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREV-TIEQTG 157
            |.|:|.|||..:.|:|.::: .:||||::||.   |:|..|:.:| :|:.:|
plant   110 FSRKFKLPENVKMDQVKASM-ENGVLTVTVPK---VEEAKKKAQVKSIDISG 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 36/113 (32%)
metazoan_ACD 61..138 CDD:107247 28/83 (34%)
AT1G07400NP_172220.1 IbpA 18..154 CDD:223149 36/113 (32%)
ACD_ScHsp26_like 49..140 CDD:107229 31/96 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126935
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.714 Consistency score
32.860

Return to query results.
Submit another query.