DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and AT1G07400

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:117 Identity:37/117 - (31%)
Similarity:63/117 - (53%) Gaps:18/117 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEG-----KSEQQEA-EQGGYSSRH 106
            |:|       |.....:|..|......|:||::.|:||:.:.|     |.|:|:. .:...||..
plant    52 WKE-------TAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVERSSGQ 109

  Fly   107 FLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREV-TIEQTG 157
            |.|:|.|||..:.|:|.::: .:||||::||.   |:|..|:.:| :|:.:|
plant   110 FSRKFKLPENVKMDQVKASM-ENGVLTVTVPK---VEEAKKKAQVKSIDISG 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 35/112 (31%)
metazoan_ACD 61..138 CDD:107247 27/82 (33%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.820

Return to query results.
Submit another query.