DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and AT5G37670

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana

Alignment Length:145 Identity:38/146 (26%)
Similarity:64/146 (44%) Gaps:35/146 (24%)


  Fly    23 PFHAFFHEPPVWSVALPRNWQQ---IARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDES 84
            ||..|            :.|.:   :..|.|...:....:|..||       :..::||::.:.:
plant    10 PFRRF------------QEWSRSTALIDWMESNNSHIFKINVPGY-------NKEDIKVQIEEGN 55

  Fly    85 VVLVEG---KSEQQE------AEQGGYS--SRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN 138
            |:.:.|   |.|::|      ||:..:|  ...||||..|||..:.|:|.:.: .:||||:.||.
plant    56 VLSIRGEGIKEEKKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQVKAYV-ENGVLTVVVPK 119

  Fly   139 PPGVQETLKEREVTI 153
            ... .::.|.|.|.|
plant   120 DTS-SKSSKVRNVNI 133

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/146 (26%)
metazoan_ACD 61..138 CDD:107247 27/88 (31%)
AT5G37670NP_198583.1 IbpA 11..133 CDD:223149 36/143 (25%)
ACD_ScHsp26_like 24..119 CDD:107229 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.