DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and HSP17.6A

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A / 831076 AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana


Alignment Length:168 Identity:39/168 - (23%)
Similarity:74/168 - (44%) Gaps:40/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PMFWRMAEEMARMPR------LSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATV--NK 61
            |:| .:.|:|...|.      .::|..|:..:....:                  |.||.|  :.
plant     9 PIF-SILEDMLEAPEEQTEKTRNNPSRAYMRDAKAMA------------------ATPADVIEHP 54

  Fly    62 DGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-------SRHFLRRFVLPEGY 117
            |.|...:|:...  .|::|::.:|:|::|.||.::...|..|..       ...|:|:|.||:..
plant    55 DAYVFAVDMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMRKFQLPDNA 119

  Fly   118 EADKVTSTLSSDGVLTISVPN-PPGVQETLKEREVTIE 154
            :.:|: |...:||||.:::|. ||  .|..|.:.:.::
plant   120 DLEKI-SAACNDGVLKVTIPKLPP--PEPKKPKTIQVQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 35/154 (23%)
metazoan_ACD 61..138 CDD:107247 23/85 (27%)
HSP17.6ANP_196764.1 HSP20 49..137 CDD:365807 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100183
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.