DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSP17.6A

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_196764.1 Gene:HSP17.6A AraportID:AT5G12030 Length:156 Species:Arabidopsis thaliana

Alignment Length:168 Identity:39/169 (23%)
Similarity:74/169 (44%) Gaps:40/169 (24%)


  Fly     5 PMFWRMAEEMARMPR------LSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATV--NK 61
            |:| .:.|:|...|.      .::|..|:..:....:                  |.||.|  :.
plant     9 PIF-SILEDMLEAPEEQTEKTRNNPSRAYMRDAKAMA------------------ATPADVIEHP 54

  Fly    62 DGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-------SRHFLRRFVLPEGY 117
            |.|...:|:...  .|::|::.:|:|::|.||.::...|..|..       ...|:|:|.||:..
plant    55 DAYVFAVDMPGIKGDEIQVQIENENVLVVSGKRQRDNKENEGVKFVRMERRMGKFMRKFQLPDNA 119

  Fly   118 EADKVTSTLSSDGVLTISVPN-PPGVQETLKEREVTIE 154
            :.:|: |...:||||.:::|. ||  .|..|.:.:.::
plant   120 DLEKI-SAACNDGVLKVTIPKLPP--PEPKKPKTIQVQ 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 35/155 (23%)
metazoan_ACD 61..138 CDD:107247 24/86 (28%)
HSP17.6ANP_196764.1 IbpA <47..137 CDD:223149 26/91 (29%)
HSP20 49..137 CDD:278440 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.