DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and HSP17.6II

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II / 831075 AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana


Alignment Length:113 Identity:33/113 - (29%)
Similarity:59/113 - (52%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 APPATV--NKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-------SRHF 107
            |.||.|  :.:.|...:|:...  .|:||:|.:::|::|.|:.:::..|..|..       ...|
plant    44 ATPADVIEHPNAYAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKF 108

  Fly   108 LRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQETLKEREVTIE 154
            :|:|.|||..:.||: |.:..||||.::|.. ||  .|..|.:.:.::
plant   109 MRKFQLPENADLDKI-SAVCHDGVLKVTVQKLPP--PEPKKPKTIQVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 25/85 (29%)
HSP17.6IINP_196763.1 HSP20 48..136 CDD:459629 25/88 (28%)

Return to query results.
Submit another query.