DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSP17.6II

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana

Alignment Length:113 Identity:33/114 (29%)
Similarity:59/114 (52%) Gaps:15/114 (13%)


  Fly    54 APPATV--NKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-------SRHF 107
            |.||.|  :.:.|...:|:...  .|:||:|.:::|::|.|:.:::..|..|..       ...|
plant    44 ATPADVIEHPNAYAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKF 108

  Fly   108 LRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQETLKEREVTIE 154
            :|:|.|||..:.||: |.:..||||.::|.. ||  .|..|.:.:.::
plant   109 MRKFQLPENADLDKI-SAVCHDGVLKVTVQKLPP--PEPKKPKTIQVQ 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 33/112 (29%)
metazoan_ACD 61..138 CDD:107247 25/86 (29%)
HSP17.6IINP_196763.1 IbpA <46..136 CDD:223149 27/91 (30%)
HSP20 48..153 CDD:278440 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T193178
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.