DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSP23.6-MITO

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_194250.1 Gene:HSP23.6-MITO AraportID:AT4G25200 Length:210 Species:Arabidopsis thaliana

Alignment Length:93 Identity:29/94 (31%)
Similarity:47/94 (50%) Gaps:12/94 (13%)


  Fly    62 DGYKLTLDVKDYSELKVKVLDESVVLV---EGKSEQQEAEQGGYSSRHFLRRFVLPEG-YEADKV 122
            |...|.:|:...|...||:..|...||   |||:|:...|:|...:|.|..|..||:. |:.|::
plant   116 DALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEI 180

  Fly   123 TSTLSSDGVLTISVPNPPGVQETLKERE 150
            .:.: .:|||.:.:|.       :||:|
plant   181 KAEM-KNGVLKVVIPK-------MKEQE 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 29/94 (31%)
metazoan_ACD 61..138 CDD:107247 26/80 (33%)
HSP23.6-MITONP_194250.1 IbpA 76..210 CDD:223149 29/94 (31%)
ACD_sHsps-like 110..195 CDD:107221 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.