DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and AT2G19310

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:175 Identity:42/175 - (24%)
Similarity:59/175 - (33%) Gaps:57/175 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 WRMAEEMARMPRLSSPFHAFF---HEPPVWSVALPR----------NWQQIARWQEQEFAPPATV 59
            |...|.|...  |..|..|.|   |.|.:.....|:          ||.:         .|.|.|
plant    19 WEPFELMNTF--LDFPSPALFLSHHFPSLSREIFPQTSSSTVNTQLNWTE---------TPTAHV 72

  Fly    60 NKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQGGY-----SSRHFLRRFVLPEGYEA 119
                :|..|...|..|: :..:||.                ||     ....|:.||.||.....
plant    73 ----FKAYLPGVDQDEV-IAFVDEE----------------GYLQICTGDNKFMSRFKLPNNALT 116

  Fly   120 DKVTSTLSSDGVLTISV-----PNPPGVQETLKEREV-TIEQTGE 158
            |:||:.: .|..|.:.|     .:||.:.|..:.|.| .:|.||:
plant   117 DQVTAWM-EDEFLVVFVEKDASSSPPQLPEIEENRNVRVVEITGD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 19/86 (22%)
AT2G19310NP_179521.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..134 CDD:469641 24/103 (23%)

Return to query results.
Submit another query.