DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb8

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001094427.2 Gene:hspb8 ZFINID:ZDB-GENE-030131-2480 Length:216 Species:Danio rerio

Alignment Length:153 Identity:39/154 (25%)
Similarity:74/154 (48%) Gaps:8/154 (5%)


  Fly    19 RLSSPFHAFFHEP-PVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKV 80
            ||.:|:....... |..|::.|:.:..:.....:..:.|.|.:.:.:|:.::|..:  .||.||.
Zfish    58 RLDAPWTGSLRSGFPRASMSSPQGFSSVYTESPRRASAPPTDSDEPWKVCVNVHSFKPEELNVKT 122

  Fly    81 LDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQET 145
            .| ..|.|.||.|::: ::||..:::|.::..:|...:...|.::||.:|||.|.....|...  
Zfish   123 KD-GFVEVSGKHEEKQ-DEGGIVTKNFTKKIQIPLDVDPVTVFASLSPEGVLIIEARQTPPYY-- 183

  Fly   146 LKEREVTIEQTGEPAKKSAEEPN 168
            |...|:..|...||..: .:||:
Zfish   184 LYSNEMPAESMEEPEAR-PQEPS 205

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 34/138 (25%)
metazoan_ACD 61..138 CDD:107247 23/79 (29%)
hspb8NP_001094427.2 ACD_HspB8_like 88..178 CDD:107235 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65183098
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.