DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb1

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis

Alignment Length:196 Identity:54/197 (27%)
Similarity:82/197 (42%) Gaps:46/197 (23%)


  Fly     9 RMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARW---QEQEFAPPAT------------ 58
            |:.::...|||:          |..|......:|....|.   |..|..||.|            
 Frog    28 RLFDQSFGMPRI----------PEDWYQWPSTSWPGYVRMLPSQSMEVVPPTTPAGATAPDFNRA 82

  Fly    59 -------------VNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFL 108
                         ...|.:|::|||..::  ||.:|..| .:|.:.||.|:::.|. |:.||.|.
 Frog    83 LSRQLSSGISEIRQTSDQWKISLDVNHFAPEELVIKTKD-GIVEITGKHEEKQDEH-GFISRCFT 145

  Fly   109 RRFVLPEGYEADKVTSTLSSDGVLTISVPNP-PGVQETLKEREVTIE---QTGEPAKKSAEEPND 169
            |::.||.|.:.:||.|:||.||:||:..|.| |.:|.......:|.:   :.|....|..||...
 Frog   146 RKYTLPPGVDINKVASSLSPDGILTVEAPLPKPAIQSAEIAIPITFQSRAEIGTTEAKKGEEATK 210

  Fly   170 K 170
            |
 Frog   211 K 211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 48/168 (29%)
metazoan_ACD 61..138 CDD:107247 32/79 (41%)
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.