DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hspb2

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 MGIID:1916503 Length:182 Species:Mus musculus

Alignment Length:147 Identity:36/148 (24%)
Similarity:62/148 (42%) Gaps:19/148 (13%)


  Fly    24 FHAFFHEPPVWSVALPRNWQQIARWQE--QEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDES 84
            :|.::..|            :.||..|  :..|....:::..::..|||..::  |:.|:.:|. 
Mouse    44 YHGYYVRP------------RAARAGEGARAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDN- 95

  Fly    85 VVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKER 149
             :|.......|..::.|:.||.|.|.:|||...:..:|.:.||.||:|.:..|. .|.....:..
Mouse    96 -LLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPR-GGRHLDTEVN 158

  Fly   150 EVTIEQTGEPAKKSAEE 166
            ||.|.....|.....||
Mouse   159 EVYISLLPAPPDPEEEE 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 33/134 (25%)
metazoan_ACD 61..138 CDD:107247 23/79 (29%)
Hspb2NP_077761.3 alpha-crystallin-Hsps_p23-like 67..148 CDD:320797 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65405135
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.