DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb2

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 / 69253 MGIID:1916503 Length:182 Species:Mus musculus


Alignment Length:147 Identity:36/147 - (24%)
Similarity:62/147 - (42%) Gaps:19/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FHAFFHEPPVWSVALPRNWQQIARWQE--QEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDES 84
            :|.::..|            :.||..|  :..|....:::..::..|||..::  |:.|:.:|. 
Mouse    44 YHGYYVRP------------RAARAGEGARAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDN- 95

  Fly    85 VVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKER 149
             :|.......|..::.|:.||.|.|.:|||...:..:|.:.||.||:|.:..|. .|.....:..
Mouse    96 -LLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPR-GGRHLDTEVN 158

  Fly   150 EVTIEQTGEPAKKSAEE 166
            ||.|.....|.....||
Mouse   159 EVYISLLPAPPDPEEEE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 22/78 (28%)
Hspb2NP_077761.3 Crystallin <21..51 CDD:425732 1/6 (17%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 22/82 (27%)

Return to query results.
Submit another query.