DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb3

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001092922.1 Gene:hspb3 ZFINID:ZDB-GENE-070705-338 Length:150 Species:Danio rerio

Alignment Length:132 Identity:32/133 (24%)
Similarity:58/133 (44%) Gaps:34/133 (26%)


  Fly    34 WSVALPRNWQQIARWQE-QE-------FA---P---PATVNKDG--------------YKLTLDV 70
            | ::.|..:||:.:.:. ||       ||   |   |..|:.:|              :::.|||
Zfish    11 W-ISSPVRYQQLFKTRNLQESTEDHRLFALPGPECLPVKVDTEGAQADSEDEDSGEPMFQILLDV 74

  Fly    71 KDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPE-GYEADKVTSTLSSDGVL 132
            ..:  .::.::|. |..:|:.|:...:..|. |..||.|.|.:.||: ...|..:.:.|..||:|
Zfish    75 TQFKPEDILIQVF-EGWLLIRGRHGVRMGEH-GLVSRSFTRHYQLPDCQLHAGDLKAMLCHDGML 137

  Fly   133 TI 134
            .:
Zfish   138 VV 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 32/133 (24%)
metazoan_ACD 61..138 CDD:107247 21/92 (23%)
hspb3NP_001092922.1 ACD_HspB3_Like 60..143 CDD:107232 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65262742
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.