DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb3

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_064344.1 Gene:Hspb3 / 56534 MGIID:1928479 Length:154 Species:Mus musculus


Alignment Length:96 Identity:27/96 - (28%)
Similarity:49/96 - (51%) Gaps:15/96 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PPATVNKDGYKLTLDVKDYSELKVKVLDESVVL--VEG----KSEQ-QEAEQGGYSSRHFLRRFV 112
            ||.. .|..:::.|||       |:.|.|.:::  .||    |::. ...::.|:.||.|.|::.
Mouse    67 PPGE-GKSRFQILLDV-------VQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYK 123

  Fly   113 LPEGYEADKVTSTLSSDGVLTISVPNPPGVQ 143
            ||:|.|...:::.|..||:|.:.|.:..|.:
Mouse   124 LPDGVETKDLSAILCHDGILVVEVKDSLGTK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 24/83 (29%)
Hspb3NP_064344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..71 2/4 (50%)
ACD_HspB3_Like 67..149 CDD:107232 26/89 (29%)

Return to query results.
Submit another query.