DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb2

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001017744.1 Gene:hspb2 / 550439 ZFINID:ZDB-GENE-050417-260 Length:169 Species:Danio rerio


Alignment Length:181 Identity:45/181 - (24%)
Similarity:81/181 - (44%) Gaps:36/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSLPMFWRMA--EEMARMPRL--------SSP--------FHAFFHEPPVWSVALPRNWQQIARW 48
            |::|..:.|:  .||...||:        .||        :|.::..|.: :..|.|.:.|:   
Zfish     4 RTVPHAYPMSMDYEMCTPPRIYDQNFAEALSPKELLAPVLYHGYYIRPRI-NKQLERGFSQV--- 64

  Fly    49 QEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRF 111
             |.|        .|.|::.|||..::  |:.|:.:|.  :|.......|..:|.|:.||.|.|.:
Zfish    65 -ESE--------DDWYRVLLDVCQFTPDEISVRTVDN--LLEVSARHAQRMDQHGFVSREFTRTY 118

  Fly   112 VLPEGYEADKVTSTLSSDGVLTISVP-NPPGVQETLKEREVTIEQTGEPAK 161
            :||.|.:...|..:||.||:|.|..| ....::..:.:.::.:|:....:|
Zfish   119 ILPMGVDPLLVQVSLSHDGILCIQAPRKTEDLEPQINQLKIKVEKKESTSK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/155 (25%)
metazoan_ACD 61..138 CDD:107247 27/79 (34%)
hspb2NP_001017744.1 ACD_HspB2_like 63..145 CDD:107231 29/95 (31%)
IbpA <64..162 CDD:223149 29/111 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.