DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hspb2

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001017744.1 Gene:hspb2 ZFINID:ZDB-GENE-050417-260 Length:169 Species:Danio rerio

Alignment Length:181 Identity:45/182 (25%)
Similarity:81/182 (45%) Gaps:36/182 (20%)


  Fly     2 RSLPMFWRMA--EEMARMPRL--------SSP--------FHAFFHEPPVWSVALPRNWQQIARW 48
            |::|..:.|:  .||...||:        .||        :|.::..|.: :..|.|.:.|:   
Zfish     4 RTVPHAYPMSMDYEMCTPPRIYDQNFAEALSPKELLAPVLYHGYYIRPRI-NKQLERGFSQV--- 64

  Fly    49 QEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRF 111
             |.|        .|.|::.|||..::  |:.|:.:|.  :|.......|..:|.|:.||.|.|.:
Zfish    65 -ESE--------DDWYRVLLDVCQFTPDEISVRTVDN--LLEVSARHAQRMDQHGFVSREFTRTY 118

  Fly   112 VLPEGYEADKVTSTLSSDGVLTISVP-NPPGVQETLKEREVTIEQTGEPAK 161
            :||.|.:...|..:||.||:|.|..| ....::..:.:.::.:|:....:|
Zfish   119 ILPMGVDPLLVQVSLSHDGILCIQAPRKTEDLEPQINQLKIKVEKKESTSK 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 38/156 (24%)
metazoan_ACD 61..138 CDD:107247 27/80 (34%)
hspb2NP_001017744.1 ACD_HspB2_like 63..145 CDD:107231 30/96 (31%)
IbpA <64..162 CDD:223149 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65394386
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.