DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hspb7

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:76 Identity:23/76 - (30%)
Similarity:36/76 - (47%) Gaps:9/76 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQ---GGYSSRHFLRRFVLPEGYEADKVT 123
            |.|:.|:||:|:|.      ::.:|.......:..||:   .|.....|..:..|||..:...|.
Zfish    71 DTYQFTVDVQDFSP------EDVIVTTSNNQIEVHAEKLASDGTVMNTFTHKCRLPEDVDPTSVK 129

  Fly   124 STLSSDGVLTI 134
            |:|.:||.|||
Zfish   130 SSLGADGTLTI 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 23/76 (30%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 23/76 (30%)

Return to query results.
Submit another query.