powered by:
Protein Alignment Hsp22 and hspb7
DIOPT Version :9
| Sequence 1: | NP_001027114.1 |
Gene: | Hsp22 / 3772576 |
FlyBaseID: | FBgn0001223 |
Length: | 174 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001006040.1 |
Gene: | hspb7 / 450019 |
ZFINID: | ZDB-GENE-041010-136 |
Length: | 161 |
Species: | Danio rerio |
| Alignment Length: | 76 |
Identity: | 23/76 - (30%) |
| Similarity: | 36/76 - (47%) |
Gaps: | 9/76 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 DGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQ---GGYSSRHFLRRFVLPEGYEADKVT 123
|.|:.|:||:|:|. ::.:|.......:..||: .|.....|..:..|||..:...|.
Zfish 71 DTYQFTVDVQDFSP------EDVIVTTSNNQIEVHAEKLASDGTVMNTFTHKCRLPEDVDPTSVK 129
Fly 124 STLSSDGVLTI 134
|:|.:||.|||
Zfish 130 SSLGADGTLTI 140
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C170582894 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.