DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryabb

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_021331756.2 Gene:cryabb / 436943 ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio


Alignment Length:117 Identity:40/117 - (34%)
Similarity:65/117 - (55%) Gaps:20/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQG-GYSSRHFLR 109
            |.|...: ...:.||.:.|:||||.::  ||.||::.:   .:|..::.::.:.| |:.||.|||
Zfish    49 WMESGVS-EVKMEKDQFSLSLDVKHFAPEELSVKIIGD---FIEIHAKHEDRQDGHGFVSREFLR 109

  Fly   110 RFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLK-----EREVTIEQT 156
            ::.:|.|.:...:||:||||||||::.|        ||     ||.:.|..|
Zfish   110 KYRVPVGVDPASITSSLSSDGVLTVTGP--------LKLSDGPERTIAIPVT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 31/79 (39%)
cryabbXP_021331756.2 Crystallin 1..48 CDD:425732
ACD_HspB4-5-6 56..137 CDD:107233 31/83 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.