DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and cryabb

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_021331756.1 Gene:cryabb ZFINID:ZDB-GENE-040718-419 Length:180 Species:Danio rerio

Alignment Length:117 Identity:40/118 (34%)
Similarity:65/118 (55%) Gaps:20/118 (17%)


  Fly    48 WQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQG-GYSSRHFLR 109
            |.|...: ...:.||.:.|:||||.::  ||.||::.:   .:|..::.::.:.| |:.||.|||
Zfish    49 WMESGVS-EVKMEKDQFSLSLDVKHFAPEELSVKIIGD---FIEIHAKHEDRQDGHGFVSREFLR 109

  Fly   110 RFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLK-----EREVTIEQT 156
            ::.:|.|.:...:||:||||||||::.|        ||     ||.:.|..|
Zfish   110 KYRVPVGVDPASITSSLSSDGVLTVTGP--------LKLSDGPERTIAIPVT 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 39/114 (34%)
metazoan_ACD 61..138 CDD:107247 32/80 (40%)
cryabbXP_021331756.1 Crystallin 1..48 CDD:306911
ACD_HspB4-5-6 56..137 CDD:107233 31/84 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65305408
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.