DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hsp27

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster

Alignment Length:118 Identity:55/119 (46%)
Similarity:81/119 (68%) Gaps:6/119 (5%)


  Fly    56 PATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYE 118
            || |.|||:::.:||..:  :||.|||:|.:|| ||||.|::| :..|...|||:|::.||:|::
  Fly    83 PA-VGKDGFQVCMDVSQFKPNELTVKVVDNTVV-VEGKHEERE-DGHGMIQRHFVRKYTLPKGFD 144

  Fly   119 ADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKSAEEPNDKA 171
            .::|.||:|||||||:..|.||..::...||.|.|:||| ||..|.:.|..:|
  Fly   145 PNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTG-PAHLSVKAPAPEA 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 47/100 (47%)
metazoan_ACD 61..138 CDD:107247 38/79 (48%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 37/79 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65253042
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.