DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hsp23

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001246694.1 Gene:Hsp23 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster

Alignment Length:190 Identity:75/191 (39%)
Similarity:111/191 (58%) Gaps:26/191 (14%)


  Fly     1 MRSLPMFWRMAEEMARMPRLSSPFHAFFHEP--------PVWSVALPRNWQQIARWQEQEFAPPA 57
            |.::|:...:|:::.||..:.      |:||        |..::..|.. ||:.:.::|..|...
  Fly     1 MANIPLLLSLADDLGRMSMVP------FYEPYYCQRQRNPYLALVGPME-QQLRQLEKQVGASSG 58

  Fly    58 T------VNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLP 114
            :      :.|||:::.:||..:  |||.|||.|.| |||||..|::| :..|:.:|||:||:.||
  Fly    59 SSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNS-VLVEGNHEERE-DDHGFITRHFVRRYALP 121

  Fly   115 EGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKSAEEPNDKAASQ 174
            .|||||||.|||||||||||.||.||.:::...||.|.|:|.| ||..:.:|...:|..|
  Fly   122 PGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVG-PAHLNVKENPKEAVEQ 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 64/153 (42%)
metazoan_ACD 61..138 CDD:107247 48/79 (61%)
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 48/80 (60%)
IbpA <69..161 CDD:223149 53/94 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130892723
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.