DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hsp67Ba

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_523998.1 Gene:Hsp67Ba FlyBaseID:FBgn0001227 Length:445 Species:Drosophila melanogaster

Alignment Length:124 Identity:50/125 (40%)
Similarity:84/125 (67%) Gaps:8/125 (6%)


  Fly    57 ATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119
            :.||::|::::::||.:  :||.||.:|..:| |||:.:::| :..|..||||:|:::||:||:.
  Fly   120 SVVNRNGFQVSMNVKQFAANELTVKTIDNCIV-VEGQHDEKE-DGHGVISRHFIRKYILPKGYDP 182

  Fly   120 DKVTSTLSSDGVLTISVPNP-PGVQETL--KEREVTIEQTGEPAK-KSAEEPNDKAASQ 174
            ::|.|||||||:||:..|.| |.|:.:|  :||.|.|:|..:..| |.|:.|......|
  Fly   183 NEVHSTLSSDGILTVKAPPPLPVVKGSLERQERIVDIQQISQQQKDKDAQPPKPSEVEQ 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/102 (43%)
metazoan_ACD 61..138 CDD:107247 34/79 (43%)
Hsp67BaNP_523998.1 metazoan_ACD 124..200 CDD:107247 33/78 (42%)
DNA_pol3_delta2 <218..>381 CDD:331068 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130892744
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.