DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hsp26

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001287000.1 Gene:Hsp26 FlyBaseID:FBgn0001225 Length:208 Species:Drosophila melanogaster

Alignment Length:130 Identity:59/131 (45%)
Similarity:85/131 (65%) Gaps:17/131 (13%)


  Fly    56 PAT--VNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEG 116
            |||  |.|||:::.:||..:  |||.|||:|:| :|||||.|::: :..|:..|||:||:.:|:|
  Fly    79 PATAHVGKDGFQVCMDVAQFKPSELNVKVVDDS-ILVEGKHEERQ-DDHGHIMRHFVRRYKVPDG 141

  Fly   117 YEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTG---------EPAKKSAEE--PNDK 170
            |:|::|.|.||||||||:|:|.|..|::..|||.:.|:|.|         |...|..|.  ||.|
  Fly   142 YKAEQVVSQLSSDGVLTVSIPKPQAVEDKSKERIIQIQQVGPAHLNVKANESEVKGKENGAPNGK 206

  Fly   171  170
              Fly   207  206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 51/102 (50%)
metazoan_ACD 61..138 CDD:107247 41/79 (52%)
Hsp26NP_001287000.1 metazoan_ACD 85..163 CDD:107247 41/80 (51%)
IbpA <87..179 CDD:223149 46/94 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130892766
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.