DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and CG4461

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster


Alignment Length:197 Identity:53/197 - (26%)
Similarity:89/197 - (45%) Gaps:38/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSLPMFWR-MAEEMARMPRLSSPFHAFFHEPPVWS----------------------------- 35
            |..:|..:| ::.|..|:..|..|.:.|...|.:|.                             
  Fly     1 MSLVPTTYRDLSREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRRVR 65

  Fly    36 ----VALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQ 94
                .:.|..|....||..........|::.|:::.:||:.:  .::.||..|: .|:|:|...:
  Fly    66 NQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDD-YVIVQGNHNR 129

  Fly    95 QEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQ-ETLKEREVTIEQTGE 158
            ::....|...|||:|:::||.||.|::|.|.:||||:|||..|.||..: .|..||.|.:.:||:
  Fly   130 RDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGK 194

  Fly   159 PA 160
            .|
  Fly   195 LA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 45/172 (26%)
metazoan_ACD 61..138 CDD:107247 28/78 (36%)
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.