Sequence 1: | NP_001027114.1 | Gene: | Hsp22 / 3772576 | FlyBaseID: | FBgn0001223 | Length: | 174 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648304.1 | Gene: | CG4461 / 39074 | FlyBaseID: | FBgn0035982 | Length: | 200 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 53/197 - (26%) |
---|---|---|---|
Similarity: | 89/197 - (45%) | Gaps: | 38/197 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MRSLPMFWR-MAEEMARMPRLSSPFHAFFHEPPVWS----------------------------- 35
Fly 36 ----VALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQ 94
Fly 95 QEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQ-ETLKEREVTIEQTGE 158
Fly 159 PA 160 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp22 | NP_001027114.1 | IbpA | 17..154 | CDD:223149 | 45/172 (26%) |
metazoan_ACD | 61..138 | CDD:107247 | 28/78 (36%) | ||
CG4461 | NP_648304.1 | metazoan_ACD | 94..169 | CDD:107247 | 26/75 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I4315 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 56 | 1.000 | Inparanoid score | I2586 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000383 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR45640 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.960 |