DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and CG4461

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_648304.1 Gene:CG4461 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster

Alignment Length:197 Identity:53/198 (27%)
Similarity:89/198 (45%) Gaps:38/198 (19%)


  Fly     1 MRSLPMFWR-MAEEMARMPRLSSPFHAFFHEPPVWS----------------------------- 35
            |..:|..:| ::.|..|:..|..|.:.|...|.:|.                             
  Fly     1 MSLVPTTYRDLSREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRRVR 65

  Fly    36 ----VALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQ 94
                .:.|..|....||..........|::.|:::.:||:.:  .::.||..|: .|:|:|...:
  Fly    66 NQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDD-YVIVQGNHNR 129

  Fly    95 QEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQ-ETLKEREVTIEQTGE 158
            ::....|...|||:|:::||.||.|::|.|.:||||:|||..|.||..: .|..||.|.:.:||:
  Fly   130 RDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGK 194

  Fly   159 PA 160
            .|
  Fly   195 LA 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 45/173 (26%)
metazoan_ACD 61..138 CDD:107247 29/79 (37%)
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 27/76 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.