DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hsp67Bc

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_523994.1 Gene:Hsp67Bc FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster

Alignment Length:128 Identity:54/129 (42%)
Similarity:77/129 (60%) Gaps:21/129 (16%)


  Fly    60 NKDG-YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADK 121
            ||.| :::.|||..:  .||.||:::|.:| ||||.|::| :..|:.||||:||:.||:.:::|.
  Fly    76 NKQGNFEVHLDVGLFQPGELTVKLVNECIV-VEGKHEERE-DDHGHVSRHFVRRYPLPKEFDSDA 138

  Fly   122 VTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGE--------------PAKKSAEEPNDK 170
            :.||||.||||.|:|| |...:|.||||.:.|:..|.              || .||.||..|
  Fly   139 IVSTLSEDGVLNITVP-PLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPA-ASASEPEAK 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 46/97 (47%)
metazoan_ACD 61..138 CDD:107247 38/80 (48%)
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 38/80 (48%)
IbpA <79..170 CDD:223149 44/94 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130892703
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.