DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and CG7409

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_648155.1 Gene:CG7409 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster

Alignment Length:131 Identity:46/132 (35%)
Similarity:66/132 (50%) Gaps:22/132 (17%)


  Fly    32 PVWSVALPR--NWQQIARWQEQEFAPPATVNKDGYKLTLDV---KDYSELKVKVLDESVVLVEGK 91
            |.|..:|.|  :...::|         ..|.|||::..:||   |.| |:.||...::|| ||.|
  Fly    33 PYWKRSLSRVGSAPDLSR---------VIVGKDGFEANVDVHLFKPY-EISVKTSGDTVV-VEAK 86

  Fly    92 SEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQT 156
            .|::. :...:..||.::|||||.||..:.|.|.|||||:||:..|     .....||.|.:.|.
  Fly    87 HEKRR-DGDTFVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCP-----PYLTNERSVYVRQV 145

  Fly   157 G 157
            |
  Fly   146 G 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/127 (35%)
metazoan_ACD 61..138 CDD:107247 35/80 (44%)
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.