DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and l(2)efl

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001261156.1 Gene:l(2)efl FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster

Alignment Length:128 Identity:54/129 (42%)
Similarity:74/129 (57%) Gaps:17/129 (13%)


  Fly    49 QEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRF 111
            |:||......::.:.:::.|||:.:  ||:.|||.|: .|:||||.|:::.|. ||.||.|.||:
  Fly    64 QKQESGSTLNIDSEKFEVILDVQQFSPSEITVKVADK-FVIVEGKHEEKQDEH-GYVSRQFSRRY 126

  Fly   112 VLPEGYEADKVTSTLSSDGVLTISVP----NPPGVQETLKEREVTIEQTGEPAKKSAEEPNDK 170
            .||.....|.|||:|||||:|||..|    .||..     ||.|.|.|||    .|::|.|.|
  Fly   127 QLPSDVNPDTVTSSLSSDGLLTIKAPMKALPPPQT-----ERLVQITQTG----PSSKEDNAK 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 47/111 (42%)
metazoan_ACD 61..138 CDD:107247 38/83 (46%)
l(2)eflNP_001261156.1 IbpA <62..167 CDD:223149 46/110 (42%)
metazoan_ACD 71..153 CDD:107247 38/84 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130892785
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.