DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and CG13133

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster

Alignment Length:124 Identity:46/125 (37%)
Similarity:66/125 (53%) Gaps:12/125 (10%)


  Fly    56 PATVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-SRHFLRRFVLPEGY 117
            |.::.:..:|:.|||..:  |||.||..:...|.||||.....||:|... :|.|.|.:.||..|
  Fly    79 PDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHY 143

  Fly   118 EADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTG-------EPAKKSAEEPND 169
            :|.:..:|.|:||:|.|:||.||.:.:.  |||:.||.||       :|....|.|..|
  Fly   144 DATQARATFSADGILMITVPAPPKLDDV--EREIEIEPTGNYFGSVSDPTAPKAIEQAD 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 39/101 (39%)
metazoan_ACD 61..138 CDD:107247 32/80 (40%)
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.