DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and HSPB1

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001531.1 Gene:HSPB1 HGNCID:5246 Length:205 Species:Homo sapiens

Alignment Length:195 Identity:54/196 (28%)
Similarity:81/196 (41%) Gaps:58/196 (30%)


  Fly     9 RMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQ-EFAPPATVNK----------- 61
            |:.::...:|||          |..||     .|...:.|... ...|||.:..           
Human    27 RLFDQAFGLPRL----------PEEWS-----QWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRA 76

  Fly    62 ----------------DGYKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFL 108
                            |.::::|||..::  ||.||..| .||.:.||.|:::.|. ||.||.|.
Human    77 LSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKD-GVVEITGKHEERQDEH-GYISRCFT 139

  Fly   109 RRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQT--------GEPAKKSAE 165
            |::.||.|.:..:|:|:||.:|.||:..|.|   :...:..|:||..|        |..|.||.|
Human   140 RKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP---KLATQSNEITIPVTFESRAQLGGPEAAKSDE 201

  Fly   166  165
            Human   202  201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 47/167 (28%)
metazoan_ACD 61..138 CDD:107247 32/106 (30%)
HSPB1NP_001531.1 Interaction with TGFB1I1. {ECO:0000250} 70..205 42/138 (30%)
ACD_HspB1_like 84..169 CDD:107230 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.