DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and CG14207

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_728275.1 Gene:CG14207 FlyBaseID:FBgn0031037 Length:192 Species:Drosophila melanogaster

Alignment Length:150 Identity:45/150 (30%)
Similarity:69/150 (46%) Gaps:26/150 (17%)


  Fly     9 RMAEEMARMPRLSSPFHAFFHE-----------PPVWSVALPRNWQQIARWQE--QEFAPPATVN 60
            :|.||||:.........|.|.|           ....:.|||   .:|.:.|.  .:.:.| .:.
  Fly    36 KMEEEMAKFRHELMNREANFFESTSSTKKTTTTSSTTNSALP---SRIPKQQNYVSDISSP-LIQ 96

  Fly    61 KDG----YKLTLDVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEA 119
            .:|    .||..||..|:  |:.||.:|:. :||..|.|::...:..|  |.:.|.|:||:|...
  Fly    97 DEGDNKVLKLRFDVSQYAPEEIVVKTVDQK-LLVHAKHEEKSDTKSVY--REYNREFLLPKGVNP 158

  Fly   120 DKVTSTLSSDGVLTISVPNP 139
            :.:.|:||.|||||:..|.|
  Fly   159 ESIRSSLSKDGVLTVDAPLP 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 40/142 (28%)
metazoan_ACD 61..138 CDD:107247 30/83 (36%)
CG14207NP_728275.1 metazoan_ACD 96..177 CDD:107247 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65252865
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.