DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryaba

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:146 Identity:50/146 - (34%)
Similarity:77/146 - (52%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPFHA-FFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDE 83
            |||:. |::.|.:|  ..|..|........|:        :|.:.:.||||.:|  ||.||| :|
Zfish    39 SPFYTMFYYRPYLW--RFPSWWDSGMSEMRQD--------RDRFVINLDVKHFSPDELTVKV-NE 92

  Fly    84 SVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKE 148
            ..:.:.||.:::: :..|..:|.|.|::.:|.|.:...:||:|||||||||   |....|..:.|
Zfish    93 DFIEIHGKHDERQ-DDHGIVAREFFRKYKIPAGVDPGAITSSLSSDGVLTI---NTLRHQLDILE 153

  Fly   149 REVTIEQTGE--PAKK 162
            |.:.| ..||  ||:|
Zfish   154 RSIPI-ICGEKPPAQK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/134 (33%)
metazoan_ACD 61..138 CDD:107247 31/78 (40%)
cryabaNP_571232.1 Crystallin 1..49 CDD:278926 4/9 (44%)
IbpA 11..142 CDD:223149 38/114 (33%)
alpha-crystallin-Hsps_p23-like 64..143 CDD:294116 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.