DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and cryaba

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:146 Identity:50/146 - (34%)
Similarity:77/146 - (52%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPFHA-FFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYS--ELKVKVLDE 83
            |||:. |::.|.:|  ..|..|........|:        :|.:.:.||||.:|  ||.||| :|
Zfish    39 SPFYTMFYYRPYLW--RFPSWWDSGMSEMRQD--------RDRFVINLDVKHFSPDELTVKV-NE 92

  Fly    84 SVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKE 148
            ..:.:.||.:::: :..|..:|.|.|::.:|.|.:...:||:|||||||||   |....|..:.|
Zfish    93 DFIEIHGKHDERQ-DDHGIVAREFFRKYKIPAGVDPGAITSSLSSDGVLTI---NTLRHQLDILE 153

  Fly   149 REVTIEQTGE--PAKK 162
            |.:.| ..||  ||:|
Zfish   154 RSIPI-ICGEKPPAQK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 31/78 (40%)
cryabaNP_571232.1 Crystallin 1..53 CDD:425732 6/15 (40%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 64..143 CDD:469641 32/91 (35%)

Return to query results.
Submit another query.