DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Cryab

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab RGDID:2414 Length:175 Species:Rattus norvegicus

Alignment Length:163 Identity:56/164 (34%)
Similarity:86/164 (52%) Gaps:27/164 (16%)


  Fly    23 PFHA-------FF--H--EPPVWSVAL--------PRNWQQIARWQEQEFAPPATVNKDGYKLTL 68
            |||:       ||  |  |..::|.|.        |.::.:...|.:...: ...:.||.:.:.|
  Rat    16 PFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLS-EMRMEKDRFSVNL 79

  Fly    69 DVKDYS--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGV 131
            |||.:|  |||||||.: |:.|.||.|:::.|. |:.||.|.|::.:|...:...:||:||||||
  Rat    80 DVKHFSPEELKVKVLGD-VIEVHGKHEERQDEH-GFISREFHRKYRIPADVDPLTITSSLSSDGV 142

  Fly   132 LTISVPNPPGVQETLKEREVTIEQTGEPAKKSA 164
            ||:   |.|..|.:..||.:.|.:..:||..:|
  Rat   143 LTV---NGPRKQASGPERTIPITREEKPAVTAA 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 53/152 (35%)
metazoan_ACD 61..138 CDD:107247 36/79 (46%)
CryabNP_037067.1 Crystallin 1..51 CDD:306911 9/35 (26%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65321335
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.