DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hsp16

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_596091.1 Gene:hsp16 PomBaseID:SPBC3E7.02c Length:143 Species:Schizosaccharomyces pombe

Alignment Length:149 Identity:36/150 (24%)
Similarity:67/150 (45%) Gaps:32/150 (21%)


  Fly    27 FFHEPPVWSVAL-------PRNWQQIARWQEQEFAPPATVNKDGYKLTLDVK-----------DY 73
            ||..||..:...       ||...||    ..|.:|...|::....:::||:           .|
pombe     6 FFGFPPTVNDLFSDFVSYSPRLNNQI----PGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHY 66

  Fly    74 SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRH---FLRRFVLPEGYEADKVTSTLSSDGVLTIS 135
            ...|:.:..|  |:.|.|:|..|..| .:|.|.   |.|...:|...:||::.:.. |:|:||::
pombe    67 DSGKLTISGE--VVNERKNESTEGNQ-RWSERRFGSFSRTITIPAKIDADRIEANF-SNGLLTVT 127

  Fly   136 VPNPPGVQETLKEREVTIE 154
            :|.   |:::..::::.|:
pombe   128 LPK---VEKSQTKKQIAIK 143

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 36/148 (24%)
metazoan_ACD 61..138 CDD:107247 23/91 (25%)
hsp16NP_596091.1 IbpA 1..143 CDD:223149 36/148 (24%)
ACD_sHsps-like 40..130 CDD:107221 24/94 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126935
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.