DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and SPCC338.06c

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_588161.1 Gene:SPCC338.06c PomBaseID:SPCC338.06c Length:139 Species:Schizosaccharomyces pombe

Alignment Length:89 Identity:22/90 (24%)
Similarity:46/90 (51%) Gaps:11/90 (12%)


  Fly    61 KDGYKLTLDVKDYSELKVKV-LDESVVLVEGKSEQQEAEQGG----YSSR---HFLRRFVLPEGY 117
            :|..::.::|....:..:|| |..|.:.:.|:.::.|.|:.|    :|.|   .|.|...||:..
pombe    42 EDTIEVDVEVPGIDKQNLKVDLHGSKLTISGERKKPEEEKAGPLIRWSERCVGAFSRTITLPQPV 106

  Fly   118 EADKVTSTLSSDGVLTISV--PNP 139
            :...:.::| ::|:|:|.:  .||
pombe   107 DEKLIHASL-NNGILSIVMKKKNP 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 22/90 (24%)
metazoan_ACD 61..138 CDD:107247 20/87 (23%)
SPCC338.06cNP_588161.1 IbpA 1..139 CDD:223149 22/90 (24%)
ACD_sHsps-like 37..126 CDD:107221 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126935
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.