DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb6

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001012401.1 Gene:Hspb6 / 243912 MGIID:2685325 Length:162 Species:Mus musculus


Alignment Length:146 Identity:48/146 - (32%)
Similarity:70/146 - (47%) Gaps:36/146 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKD-GY-KLTLDVKDY 73
            ||..:..|...:|:  :...|   ||||                |.|.|:.| || .:.||||.:
Mouse    40 AELASLCPAAIAPY--YLRAP---SVAL----------------PTAQVSTDSGYFSVLLDVKHF 83

  Fly    74 --SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTI-- 134
              .|:.|||:|:.|. |..:.|::..|. |:.:|.|.||:.||.|.:...|||.||.:|||:|  
Mouse    84 LPEEISVKVVDDHVE-VHARHEERPDEH-GFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQA 146

  Fly   135 -------SVPNPPGVQ 143
                   .:|:||..:
Mouse   147 TPASAQAQLPSPPAAK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 33/89 (37%)
Hspb6NP_001012401.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 13/52 (25%)
Crystallin 3..62 CDD:425732 7/26 (27%)
ACD_HspB4-5-6 66..148 CDD:107233 34/83 (41%)

Return to query results.
Submit another query.