DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Cryaa

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa RGDID:2413 Length:196 Species:Rattus norvegicus

Alignment Length:143 Identity:44/144 (31%)
Similarity:72/144 (50%) Gaps:25/144 (17%)


  Fly    25 HAFF--HEPPVWSVALPRNWQQIARWQEQEFAPPATV--NKDGYKLTLDVKDYS--ELKVKVLDE 83
            |.:|  |:|...:   |:|             .|..|  ::|.:.:.||||.:|  :|.|||| |
  Rat    67 HMWFVMHQPHAGN---PKN-------------NPGKVRSDRDKFVIFLDVKHFSPEDLTVKVL-E 114

  Fly    84 SVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN-PPGVQETLK 147
            ..|.:.||..::: :..||.||.|.||:.||...:...::.:||:||:||.|.|. ..|:.....
  Rat   115 DFVEIHGKHNERQ-DDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHS 178

  Fly   148 EREVTIEQTGEPA 160
            ||.:.:.:..:|:
  Rat   179 ERAIPVSREEKPS 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 43/136 (32%)
metazoan_ACD 61..138 CDD:107247 32/79 (41%)
CryaaNP_001276666.1 Crystallin 1..50 CDD:278926
alpha-crystallin-Hsps_p23-like 86..168 CDD:294116 33/84 (39%)
IbpA <87..168 CDD:223149 33/83 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65243023
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.