DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and Hspb6

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 / 192245 RGDID:621554 Length:162 Species:Rattus norvegicus


Alignment Length:146 Identity:49/146 - (33%)
Similarity:70/146 - (47%) Gaps:36/146 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKD-GY-KLTLDVKDY 73
            ||..:..|...:|:  :...|   ||||                |.|.|..| || .:.||||.:
  Rat    40 AELASLCPAAIAPY--YLRAP---SVAL----------------PTAQVPTDPGYFSVLLDVKHF 83

  Fly    74 S--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTI-- 134
            |  |:.|||:.:.|. |..:.|::..|. |:.:|.|.||:.||.|.:...|||.||.:|||:|  
  Rat    84 SPEEISVKVVGDHVE-VHARHEERPDEH-GFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQA 146

  Fly   135 -------SVPNPPGVQ 143
                   |:|:||..:
  Rat   147 TPASAQASLPSPPAAK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 47/140 (34%)
metazoan_ACD 61..138 CDD:107247 34/89 (38%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000250|UniProtKB:O14558 1..72 13/52 (25%)
Crystallin 3..58 CDD:395419 4/19 (21%)
ACD_HspB4-5-6 66..148 CDD:107233 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.