DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and Hspb6

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_620242.1 Gene:Hspb6 RGDID:621554 Length:162 Species:Rattus norvegicus

Alignment Length:146 Identity:49/147 (33%)
Similarity:70/147 (48%) Gaps:36/147 (24%)


  Fly    11 AEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKD-GY-KLTLDVKDY 73
            ||..:..|...:|:  :...|   ||||                |.|.|..| || .:.||||.:
  Rat    40 AELASLCPAAIAPY--YLRAP---SVAL----------------PTAQVPTDPGYFSVLLDVKHF 83

  Fly    74 S--ELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTI-- 134
            |  |:.|||:.:.|. |..:.|::..|. |:.:|.|.||:.||.|.:...|||.||.:|||:|  
  Rat    84 SPEEISVKVVGDHVE-VHARHEERPDEH-GFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQA 146

  Fly   135 -------SVPNPPGVQ 143
                   |:|:||..:
  Rat   147 TPASAQASLPSPPAAK 162

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 47/141 (33%)
metazoan_ACD 61..138 CDD:107247 35/90 (39%)
Hspb6NP_620242.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. {ECO:0000250|UniProtKB:O14558} 1..72 13/53 (25%)
Crystallin 5..56 CDD:278926 4/18 (22%)
ACD_HspB4-5-6 66..148 CDD:107233 34/84 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.