DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and ZK1128.7

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499252.2 Gene:ZK1128.7 / 191528 WormBaseID:WBGene00014233 Length:205 Species:Caenorhabditis elegans


Alignment Length:81 Identity:22/81 - (27%)
Similarity:44/81 - (54%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TVNKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYS-SRHFLRRFVLPEGYEA 119
            |....|:.:.:||..:  .|:||.:.|:::.:   ..|:.|:...|:: .|.|.|::.:|:....
 Worm    98 TNTSHGFTIEIDVFHFMPEEIKVVLTDDTLSI---SGERFESTGDGHTLRRSFSRKYSIPDDVHL 159

  Fly   120 DKVTSTLSSDGVLTIS 135
            |.:.|.|::.|||.|:
 Worm   160 DTIRSHLTNSGVLIIN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 21/78 (27%)
ZK1128.7NP_499252.2 metazoan_ACD 96..178 CDD:107247 22/81 (27%)

Return to query results.
Submit another query.