DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp-17

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:135 Identity:37/135 - (27%)
Similarity:62/135 - (45%) Gaps:25/135 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MPRLSSPFHAFFHE---------------PPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKL 66
            |.|...||..||:.               .|.|:.      |.:........|.....|...|.:
 Worm     1 MDRRFPPFSPFFNHGRRFFDDVDFDRHMIRPYWAD------QTMLTGHRVGDAIDVVNNDQEYNV 59

  Fly    67 TLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSD 129
            ::||..:  .||||.::|..:: :||| ..::.::.|...|||:|::.||.|...:::.|.||::
 Worm    60 SVDVSQFEPEELKVNIVDNQLI-IEGK-HNEKTDKYGQVERHFVRKYNLPTGVRPEQIKSELSNN 122

  Fly   130 GVLTI 134
            ||||:
 Worm   123 GVLTV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 37/135 (27%)
metazoan_ACD 61..138 CDD:107247 26/76 (34%)
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.