DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and F08H9.4

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_506586.1 Gene:F08H9.4 WormBaseID:WBGene00008592 Length:147 Species:Caenorhabditis elegans

Alignment Length:85 Identity:27/86 (31%)
Similarity:43/86 (50%) Gaps:5/86 (6%)


  Fly    60 NKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKV 122
            :.|.:.:.|:|.::  .||||. |:...:.::|  |.....:.|.|.:.|.|..:|||..:...|
 Worm    48 SNDKFAVNLNVSNFKPEELKVN-LEGRQLSIQG--EHDVENEHGASRKSFSRMILLPEDVDITSV 109

  Fly   123 TSTLSSDGVLTISVPNPPGV 142
            .:.||:||.|.|..|...||
 Worm   110 ATNLSNDGKLCIEAPKLEGV 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 27/86 (31%)
metazoan_ACD 61..138 CDD:107247 25/79 (32%)
F08H9.4NP_506586.1 IbpA 4..127 CDD:223149 25/82 (30%)
metazoan_ACD 47..125 CDD:107247 25/80 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65210866
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.940

Return to query results.
Submit another query.