DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and F08H9.4

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_506586.1 Gene:F08H9.4 / 184215 WormBaseID:WBGene00008592 Length:147 Species:Caenorhabditis elegans


Alignment Length:85 Identity:27/85 - (31%)
Similarity:43/85 - (50%) Gaps:5/85 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NKDGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKV 122
            :.|.:.:.|:|.::  .||||. |:...:.::|  |.....:.|.|.:.|.|..:|||..:...|
 Worm    48 SNDKFAVNLNVSNFKPEELKVN-LEGRQLSIQG--EHDVENEHGASRKSFSRMILLPEDVDITSV 109

  Fly   123 TSTLSSDGVLTISVPNPPGV 142
            .:.||:||.|.|..|...||
 Worm   110 ATNLSNDGKLCIEAPKLEGV 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 27/85 (32%)
metazoan_ACD 61..138 CDD:107247 24/78 (31%)
F08H9.4NP_506586.1 metazoan_ACD 47..125 CDD:107247 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.950

Return to query results.
Submit another query.