DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and F08H9.3

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_506585.1 Gene:F08H9.3 WormBaseID:WBGene00008591 Length:147 Species:Caenorhabditis elegans

Alignment Length:104 Identity:29/105 (28%)
Similarity:48/105 (46%) Gaps:19/105 (18%)


  Fly    50 EQEFAPPATVNKD-------------GYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQ 99
            ::|:.|.:..|.|             .:.:.|:|.|.  .|||:.:....:.:   |:|.||.|.
 Worm    24 DREYVPISENNDDLSDCRNEIVDTHEKFSVNLNVPDVKPEELKINLEGRKLSI---KAEHQEIEN 85

  Fly   100 GGYS-SRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVP 137
            ...| ::.:.:..||||..:...::|.||.||.|.|.||
 Worm    86 DNISTTQTYSKSIVLPEDVDVTHLSSNLSEDGKLLIEVP 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 29/105 (28%)
metazoan_ACD 61..138 CDD:107247 26/94 (28%)
F08H9.3NP_506585.1 IbpA <43..132 CDD:223149 25/86 (29%)
metazoan_ACD 43..125 CDD:107247 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65210897
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.