DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hsp-25

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans

Alignment Length:82 Identity:30/83 (36%)
Similarity:49/83 (59%) Gaps:7/83 (8%)


  Fly    62 DG--YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKV 122
            ||  .:|..||.:|  .|:.||.:|.. :||..|.|::..::..:  |.:.:.|:||.|...:::
 Worm   135 DGKTLRLRFDVANYKPEEVTVKTIDNR-LLVHAKHEEKTPQRTVF--REYNQEFLLPRGTNPEQI 196

  Fly   123 TSTLSSDGVLTISVPNP 139
            :||||:|||||:..|.|
 Worm   197 SSTLSTDGVLTVEAPLP 213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 30/83 (36%)
metazoan_ACD 61..138 CDD:107247 29/80 (36%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.