DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hsp-16.1

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_505354.1 Gene:hsp-16.1 WormBaseID:WBGene00002015 Length:145 Species:Caenorhabditis elegans

Alignment Length:158 Identity:47/159 (30%)
Similarity:75/159 (47%) Gaps:27/159 (17%)


  Fly    22 SPFHAFFHEPPVWSV--ALPRNWQQIARWQEQEFAP-----PA----TVNKD-GYKLTLDVKDYS 74
            |.:|.|  .|...||  .|.|:..|:    |::|.|     |:    .||.| .:.:.|:|..:.
 Worm     2 SLYHYF--RPAQRSVFGDLMRDMAQM----ERQFTPVCRGSPSESSEIVNNDQKFAINLNVSQFK 60

  Fly    75 ELKVKV-LDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPN 138
            ...:|: ||...:.::|  ||:...:.|||.:.|.|..:|||..:...|.|.||.||.|:|..|.
 Worm    61 PEDLKINLDGHTLSIQG--EQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPK 123

  Fly   139 PPGVQETLKEREVTIEQTGEPAKKSAEE 166
                :|.::.|.:.|:|.  |.::...|
 Worm   124 ----KEAIQGRSIPIQQA--PVEQKTSE 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 44/145 (30%)
metazoan_ACD 61..138 CDD:107247 26/79 (33%)
hsp-16.1NP_505354.1 IbpA 17..134 CDD:223149 37/127 (29%)
metazoan_ACD 42..123 CDD:107247 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65210922
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.890

Return to query results.
Submit another query.