DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp-16.41

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_872116.2 Gene:hsp-16.41 / 178660 WormBaseID:WBGene00002018 Length:143 Species:Caenorhabditis elegans


Alignment Length:98 Identity:30/98 - (30%)
Similarity:48/98 - (48%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VNKDG-YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEAD 120
            ||.:. :.:.|||..:  ..||:| ||...:.:||  .|:...:.||..|.|.:..:|||..:..
 Worm    48 VNDESKFSVQLDVSHFKPENLKIK-LDGRELKIEG--IQETKSEHGYLKRSFSKMILLPEDADLP 109

  Fly   121 KVTSTLSSDGVLTISVPNPPGVQETLKEREVTI 153
            .|.|.:|::|.|.|..|     ::|...|.:.|
 Worm   110 SVKSAISNEGKLQIEAP-----KKTNSSRSIPI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 24/79 (30%)
hsp-16.41NP_872116.2 metazoan_ACD 46..127 CDD:107247 27/86 (31%)

Return to query results.
Submit another query.