DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and hsp-16.41

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_872116.2 Gene:hsp-16.41 WormBaseID:WBGene00002018 Length:143 Species:Caenorhabditis elegans

Alignment Length:98 Identity:30/99 (30%)
Similarity:48/99 (48%) Gaps:11/99 (11%)


  Fly    59 VNKDG-YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEAD 120
            ||.:. :.:.|||..:  ..||:| ||...:.:||  .|:...:.||..|.|.:..:|||..:..
 Worm    48 VNDESKFSVQLDVSHFKPENLKIK-LDGRELKIEG--IQETKSEHGYLKRSFSKMILLPEDADLP 109

  Fly   121 KVTSTLSSDGVLTISVPNPPGVQETLKEREVTI 153
            .|.|.:|::|.|.|..|     ::|...|.:.|
 Worm   110 SVKSAISNEGKLQIEAP-----KKTNSSRSIPI 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 30/99 (30%)
metazoan_ACD 61..138 CDD:107247 25/80 (31%)
hsp-16.41NP_872116.2 metazoan_ACD 46..127 CDD:107247 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C65461577
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.940

Return to query results.
Submit another query.