DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and hsp-12.6

DIOPT Version :10

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_501668.1 Gene:hsp-12.6 / 177778 WormBaseID:WBGene00002013 Length:110 Species:Caenorhabditis elegans


Alignment Length:76 Identity:21/76 - (27%)
Similarity:39/76 - (51%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DGYKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQ-EAEQGGYSSRHFLRRFVLPEGYEADKVT 123
            |.:::.|:..::  .|::||.:.|   |:|...|.. :.:..|..||:..|.:.||:..:...:.
 Worm    32 DHFEVGLEAHNFLPKEIEVKNIGE---LLEIHMEHNVKKDSFGDVSRNITRCYKLPKNVDMKTIK 93

  Fly   124 STLSSDGVLTI 134
            |.|.|.|:|.|
 Worm    94 SNLDSHGILHI 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 metazoan_ACD 61..138 CDD:107247 21/76 (28%)
hsp-12.6NP_501668.1 metazoan_ACD 27..108 CDD:107247 21/76 (28%)

Return to query results.
Submit another query.