DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hsp22 and sip-1

Sequence 1:NP_001027114.1 Gene:Hsp22 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499316.1 Gene:sip-1 WormBaseID:WBGene00004798 Length:159 Species:Caenorhabditis elegans

Alignment Length:118 Identity:33/119 (28%)
Similarity:55/119 (46%) Gaps:11/119 (9%)


  Fly    24 FHAFFHEPPVWSV--ALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDES 84
            |..|....|.|:.  ::..|:..|...|..|....|    ..:.:.|||..:  .||||. |:..
 Worm    15 FRDFEDMMPYWAQRHSMLNNFNNIVPQQLNEVENTA----QKFCVKLDVAAFKPEELKVN-LEGH 74

  Fly    85 VVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVP 137
            |:.:||..|.:  .:.|:|.|.|.|:|.||:..:...:.:.::.:|.:||..|
 Worm    75 VLTIEGHHEVK--TEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAP 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 33/119 (28%)
metazoan_ACD 61..138 CDD:107247 24/80 (30%)
sip-1NP_499316.1 IbpA <45..129 CDD:223149 26/89 (29%)
metazoan_ACD 45..126 CDD:107247 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000089
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
66.010

Return to query results.
Submit another query.