DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp22 and sip-1

DIOPT Version :9

Sequence 1:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_499316.1 Gene:sip-1 / 176471 WormBaseID:WBGene00004798 Length:159 Species:Caenorhabditis elegans


Alignment Length:118 Identity:33/118 - (27%)
Similarity:55/118 - (46%) Gaps:11/118 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FHAFFHEPPVWSV--ALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDY--SELKVKVLDES 84
            |..|....|.|:.  ::..|:..|...|..|....|    ..:.:.|||..:  .||||. |:..
 Worm    15 FRDFEDMMPYWAQRHSMLNNFNNIVPQQLNEVENTA----QKFCVKLDVAAFKPEELKVN-LEGH 74

  Fly    85 VVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVP 137
            |:.:||..|.:  .:.|:|.|.|.|:|.||:..:...:.:.::.:|.:||..|
 Worm    75 VLTIEGHHEVK--TEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 33/118 (28%)
metazoan_ACD 61..138 CDD:107247 24/79 (30%)
sip-1NP_499316.1 IbpA <45..129 CDD:223149 26/88 (30%)
metazoan_ACD 45..126 CDD:107247 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.920

Return to query results.
Submit another query.